PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009134989.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 351aa    MW: 38638.5 Da    PI: 5.4519
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009134989.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.93.1e-06444539
        zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                    +C+ +++++   +C++++ +lC +C  + H+       H++
  XP_009134989.1  4 MCDFCGDQRSMVYCRSDSACLCLSCDRSVHSAnalskrHSR 44
                    6*****************************65677777765 PP

2zf-B_box26.41.4e-084690441
        zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg.......Htvvp 41
                     +C++++ ++++  C + ++ lC++C  ++H++       H++++
  XP_009134989.1 46 LVCERCNAQPATVRCVEERVSLCQNCDWSGHNNnstssndHKRQT 90
                    68*****************************88899999999876 PP

3CCT60.55.6e-21294337144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     R++a++RYkeK+k RkF+K++rY+sRKa+A+ R RvKGrFvk+ 
  XP_009134989.1 294 RNNAVMRYKEKKKARKFDKRVRYASRKARADVRRRVKGRFVKAG 337
                     99***************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.855147IPR000315B-box-type zinc finger
CDDcd000212.19E-7447No hitNo description
SMARTSM003365.9E-9447IPR000315B-box-type zinc finger
PROSITE profilePS501199.5134391IPR000315B-box-type zinc finger
CDDcd000211.45E-54776No hitNo description
SMARTSM003360.274891IPR000315B-box-type zinc finger
PfamPF062039.5E-16294336IPR010402CCT domain
PROSITE profilePS5101715.338294336IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MGYMCDFCGD QRSMVYCRSD SACLCLSCDR SVHSANALSK RHSRTLVCER CNAQPATVRC  60
VEERVSLCQN CDWSGHNNNS TSSNDHKRQT ISCYSGCPSS SELASIWSFC SELAGESACE  120
QEMGMMNIDD DGQTKENCNE DKKDETSSAA QATNASFAKD VGVCEDDFYG NLGMDEVDLA  180
LDNYEELFGT AFNTSVHLFG QGGVDSLFQK HQQAAAPEGG NLVQPAESND DSFMSSKTEP  240
IICYTSKPAH SNISFSGVTG ESSAGDFQEC GASSSVQLTG EPPWHPQTSQ SVTRNNAVMR  300
YKEKKKARKF DKRVRYASRK ARADVRRRVK GRFVKAGEAY DYDPLTPTRS Y
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.319411e-131leaf| silique
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2373311e-85AC237331.1 Arabidopsis lyrata clone JGIFAFI-57H17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009134989.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
SwissprotQ9SSE50.0COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLM4CAN50.0M4CAN5_BRARP; Uncharacterized protein
STRINGBra001264.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16822786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.40.0CONSTANS-like 9